The domain within your query sequence starts at position 252 and ends at position 363; the E-value for the AdoMet_MTase domain shown below is 3.1e-42.

LVSILRYSRMYQELKEKYRDMVKVWPEVTDPEKFVYEDVAIATYLLILWEEERAEKGVTT
KQSFVDLGCGNGLLVHILSNEGHPGRGIDIRRRKIWDMYGPQTQLEEGSITP

AdoMet_MTase

AdoMet_MTase
PFAM accession number:PF07757
Interpro abstract (IPR011671):

tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [(PUBMED:18025252)].

GO function:methyltransferase activity (GO:0008168)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AdoMet_MTase