The domain within your query sequence starts at position 64 and ends at position 250; the E-value for the Afaf domain shown below is 1.1e-86.
PANEKTGNYYKDIKQYVFTTPNIKGSEVSVTATTNLEFAVKKNYKASKPTASGEEEKPSE SSRKTSTPNIPAFWTILSKAVNETAVSMDDKDQFFQPIPASDLNATNEDKLSELEEIKLK LMLGISLMTLVLLIPLLIFCFATLYKLRHLRDKSYESQYSINPELATLSYFHPTEGSNQT VLTDESS
Afaf |
---|
PFAM accession number: | PF15339 |
---|---|
Interpro abstract (IPR029282): | Equatorin (also known as Afaf) is an acrosomal membrane-anchored protein involved in membrane trafficking during acrosome formation and participate in fertilisation [ (PUBMED:9674989) (PUBMED:19285662) ]. In mice, it is localised in the inner and outer membrane of forming acrosomes (Acrs), and declined in the maturing Acrs [ (PUBMED:16831425) ]. |
GO process: | fusion of sperm to egg plasma membrane involved in single fertilization (GO:0007342), acrosomal vesicle exocytosis (GO:0060478), endocytosis (GO:0006897) |
GO component: | plasma membrane (GO:0005886) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Afaf