The domain within your query sequence starts at position 59 and ends at position 120; the E-value for the Agenet domain shown below is 3.9e-14.

ISEGDEVEVYSRANDQEPCGWWLAKVRMMKGEFYVIEYAACDATYNEIVTFERLRPVNQN
KT

Agenet

Agenet
PFAM accession number:PF05641
Interpro abstract (IPR008395):

Fragile X Mental Retardation Protein (FMRP), and its autosomal paralogues, Fragile X mental Retardation syndrome-related protein 1 and 2 (FXR1 and FXR2), comprise a family of RNA-binding proteins. It is thought that the FRMP family of proteins contributes to the regulation of protein synthesis at sites where mRNAs are locally translated in response to stimuli. These proteins are highly similar to one another and also retain highly conserved domain architecture. The two ribonucleoprotein K homology (KH) domains and the cluster of arginine and glycine residues that constitute the RGG box, comprise a large region that is important for RNA binding and polyribosome association. In addition, two Agenet-like domains exist in tandem within the N-terminal regions of FMRP family proteins. The Agenet-like domain belongs to the "Royal" domain superfamilly which contains also the Tudor, chromo, MBT, PWWP and plant Agenet domains. Biochemical analysis of the tandem Agenet-like domains reveals their ability to preferentially recognise trimethylated peptides in a sequence-specific manner [(PUBMED:12575993), (PUBMED:12950170), (PUBMED:16407062), (PUBMED:21072162)].

The Agenet-like domain folds into a bent four-stranded antiparallel beta sheet with a fifth strand closing the cavity of the sheet, similar to a thumb across a semiclosed hand [(PUBMED:16407062), (PUBMED:21072162)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Agenet