The domain within your query sequence starts at position 955 and ends at position 1095; the E-value for the Ago_hook domain shown below is 1.2e-28.

REPNLPTPMTGKSASVWSKSTPPAPDNGTSAWGEPNESSPGWGEMDDAGASTTGWGNTPA
NAPNAMKPNSKSMQDGWGESDGPVTGARHPSWEEEDDGGVWNTAGSQGSTSSHNSASWGQ
GGKKQMKCSLKGGNNDSWMNP

Ago_hook

Ago_hook
PFAM accession number:PF10427
Interpro abstract (IPR019486):

This entry represents a region called the argonaute hook [(PUBMED:17891150)]. It has been shown to bind to the Piwi domain (IPR003165) of argnonaute proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ago_hook