The domain within your query sequence starts at position 8 and ends at position 113; the E-value for the Aida_N domain shown below is 2.3e-49.
LLQRWGASLRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKKTIGKIA TCLELRSAALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQ
Aida_N |
---|
PFAM accession number: | PF08910 |
---|---|
Interpro abstract (IPR023421): | This entry represents the N-terminal domain of the axin interactor, dorsalization-associated protein family AIDA [ (PUBMED:17681137) ]. AIDA acts as a ventralizing factor during embryogenesis. It inhibits axin-mediated JNK activation by binding axin and disrupting axin homodimerization. This in turn antagonizes a Wnt/beta-catenin-independent dorsalization pathway activated by axin/JNK-signaling [ (PUBMED:17681137) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Aida_N