The domain within your query sequence starts at position 42 and ends at position 93; the E-value for the AlaDh_PNT_C domain shown below is 1.3e-9.

EQLLKVVTLGLNRTSKPQKVVVVGAGVAGLVAAKMLSDAGHKVTILEADNRI

AlaDh_PNT_C

AlaDh_PNT_C
PFAM accession number:PF01262
Interpro abstract (IPR007698):

Alanine dehydrogenase catalyses the NAD-dependent reversible reductive amination of pyruvate into alanine. Pyridine nucleotide transhydrogenase catalyses the reduction of NADP+ to NADPH with the concomitant oxidation of NADH to NAD+. This enzyme is located in the plasma membrane of prokaryotes and in the inner membrane of the mitochondria of eukaryotes. The transhydrogenation between NADH and NADP is coupled with the translocation of a proton across the membrane. In prokaryotes the enzyme is composed of two different subunits, an alpha chain (gene pntA) and a beta chain (gene pntB), while in eukaryotes it is a single chain protein.

The sequence of alanine dehydrogenase from several bacterial species is related with that of the alpha subunit of bacterial pyridine nucleotide transhydrogenase and the N-terminal half of the eukaryotic enzyme. The two most conserved regions correspond respectively to the N-terminal domain of these proteins, and to a central glycine-rich region which is part of the NAD(H)-binding site [(PUBMED:8439307)]. This entry represents a domain found in alanine dehydrogenase and pyridine nucleotide transhydrogenase, containing the glycine-rich region. This domain is also found in lysine 2-oxoglutarate reductases [(PUBMED:11354603)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AlaDh_PNT_C