The domain within your query sequence starts at position 205 and ends at position 343; the E-value for the AlbA_2 domain shown below is 2.3e-17.

ESTSIEFKQFDTENAQKYMKDIIPEYISAFANTQGGYLFIGVDDKSIILGCPKDNVDPDS
LKIVANEAISKLPVFHFCSSKDKNKVSYETRVIDVFQEGNLYGYLCVIKVEPFCCAVFSE
APISWMVDKEKGVYTLNTE

AlbA_2

AlbA_2
PFAM accession number:PF04326
Interpro abstract (IPR007421):

AAA ATPases form a large, functionally diverse protein family belonging to the AAA+ superfamily of ring-shaped P-loop NTPases, which exert their activity through the energy-dependent unfolding of macromolecules. AAA ATPases contain a P-loop NTPase domain, which is the most abundant class of NTP-binding protein fold, and is found throughout all kingdoms of life [(PUBMED:15037234)]. P-loop NTPase domains act to hydrolyse the beta-gamma phosphate bond of bound nucleoside triphosphate. There are two classes of P-loop domains: the KG (kinase-GTPase) division, and the ASCE division, the latter including the AAA+ group as well as several other ATPases.

There are at least six major clades of AAA domains (metalloproteases, meiotic proteins, D1 and D2 domains of ATPases with two AAA domains, proteasome subunits, and BSC1), as well as several minor clades, some of which consist of hypothetical proteins [(PUBMED:15037233)]. The domain organisation of AAA ATPases consists of a non-ATPase N-terminal domain that acts in substrate recognition, followed by one or two AAA domains (D1 and D2), one of which may be degenerate.

This entry is related to IPR003959, and presumably has the same function (ATP-binding). A number of the archaeal members of this group are annotated as ATP-dependent DNA helicases EC 3.6.1.

GO function:ATP binding (GO:0005524)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AlbA_2