The domain within your query sequence starts at position 26 and ends at position 90; the E-value for the Alba domain shown below is 8.2e-16.

LEMRVRDGSKIRNLLGLALGRLEGGSTRHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLT
KLRFL

Alba

Alba
PFAM accession number:PF01918
Interpro abstract (IPR002775):

Members of this group include the archaeal protein Alba and eukaryotic Ribonuclease P subunits Pop7/Rpp20 and Rpp25. The Alba domain is closely related to the RNA-binding versions of the IF3-C fold such as YhbY and IF3-C. The eukaryotic lineages of the Alba family are principally involved in RNA metabolism, suggesting that the ancestral function of the IF3-C fold was related to RNA interaction [ (PUBMED:14519199) ].

Alba has been shown to bind DNA and affect DNA supercoiling in a temperature dependent manner [ (PUBMED:10869069) ]. It is regulated by acetylation (alba = acetylation lowers binding affinity) by the Sir2 protein. Alba is proposed to play a role in establishment or maintenance of chromatin architecture and thereby in transcription repression. For further information see [ (PUBMED:16256418) ].

GO function:nucleic acid binding (GO:0003676)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Alba