The domain within your query sequence starts at position 1 and ends at position 159; the E-value for the Aldose_epim domain shown below is 6.1e-41.
XTNHSYFNLAGQGSPNIYDHEVTIAADAYLPVDETLIPTGVIAPVEGTAFDLRKPVELGT HLQDYHIHGFDHNFCLKESKEKKFCARVRHAASGRILEVYTTQPGVQFYTGNFLDGTLKG KNGAVYPKHSGLCLETQNWPDSVNQVKPQARLSEWRRST
Aldose_epim |
---|
PFAM accession number: | PF01263 |
---|---|
Interpro abstract (IPR008183): | Aldose 1-epimerase ( EC 5.1.3.3 ) (mutarotase) is the enzyme responsible for the anomeric interconversion of D-glucose and other aldoses between their alpha- and beta-forms. Glucose-6-phosphate 1-epimerase ( EC 5.1.3.3 ) has been shown to catalyse the interconversion between the alpha and beta anomers from at least three hexose 6-phosphate sugars (Glc6P, Gal6P, and Man6P) [ (PUBMED:16857670) ]. |
GO process: | carbohydrate metabolic process (GO:0005975) |
GO function: | isomerase activity (GO:0016853) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Aldose_epim