The domain within your query sequence starts at position 39 and ends at position 216; the E-value for the Alg14 domain shown below is 1.9e-70.
LLIVAGSGGHTTEILRLVGSLSNAYSPRHYVIAESDEMSAKKIHSLEELSRAQNDSTTEY PKYHLHRIPRSREVRQSWLSSVFTTFYSMWFSFPLVLRIKPDLVLCNGPGTCVPICVSAL LLGILGVKKVIIVYVESICRVETLSLSGKILRHLSDYFIVQWPTLKEKYPKSVYLGRI
Alg14 |
---|
PFAM accession number: | PF08660 |
---|---|
Interpro abstract (IPR013969): | Alg14 is involved dolichol-linked oligosaccharide biosynthesis and anchors the catalytic subunit Alg13 to the ER membrane [ (PUBMED:16100110) ]. |
GO process: | dolichol-linked oligosaccharide biosynthetic process (GO:0006488) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Alg14