The domain within your query sequence starts at position 18 and ends at position 140; the E-value for the Alkyl_sulf_C domain shown below is 5e-11.
APTSSAGDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNG KGSVLPNSDKKADCTITMADSDLLALMTGKMNPQSAFFQGKLKIAGNMGLAMKLQNLQLQ PGK
Alkyl_sulf_C |
---|
PFAM accession number: | PF14864 |
---|---|
Interpro abstract (IPR029229): | This domain is found at the C terminus of alkyl sulfatases. Together with the N-terminal catalytic domain, this domain forms a hydrophobic chute and may recruit hydrophobic substrates [ (PUBMED:16684886) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Alkyl_sulf_C