The domain within your query sequence starts at position 2 and ends at position 153; the E-value for the Alpha-2-MRAP_C domain shown below is 4.7e-48.

ELHSDLKIQERDELNWKKLKDRLRSINQGLDRLRKVSHQGYGSTTEFEEPRVIDLWDLAQ
SANFTEKELESFREELKHFEAKIEKHNHYQKQLEISHQKLKHVESIGDPEHISRNKEKYV
LLEEKTKELGYKVKKHLQDLSSRVSRARHNEL

Alpha-2-MRAP_C

Alpha-2-MRAP_C
PFAM accession number:PF06401
Interpro abstract (IPR010483):

The alpha-2-macroglobulin receptor-associated protein (RAP) is a intracellular glycoprotein that binds to the 2-macroglobulin receptor and other members of the low density lipoprotein receptor family. The protein inhibits binding of all currently known ligands of these receptors [ (PUBMED:9207124) ]. Two different studies have provided conflicting domain boundaries.

GO component:endoplasmic reticulum (GO:0005783)
GO function:heparin binding (GO:0008201), low-density lipoprotein particle receptor binding (GO:0050750)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Alpha-2-MRAP_C