The domain within your query sequence starts at position 27 and ends at position 134; the E-value for the Amidohydro_1 domain shown below is 2.7e-7.

ILAPGFIDVQINGGFGVDFSKATEDVGSGVALVARRLLSHGVTSFCPTLVTSPPEVYHKA
HSSSYKCARSSWALPGRPCSCEPCPHAPSPPLCFPHAAGSTGKVLPQI

Amidohydro_1

Amidohydro_1
PFAM accession number:PF01979
Interpro abstract (IPR006680):

Proteins containing this domain are enzymes from a large metal dependent hydrolase superfamily [ (PUBMED:9144792) ]. The family includes adenine deaminase ( EC 3.5.4.2 ) that hydrolyses adenine to form hypoxanthine and ammonia. This reaction is important for adenine utilisation as a purine and also as a nitrogen source [ (PUBMED:8550522) ]. The family also includes dihydroorotase and N-acetylglucosamine-6-phosphate deacetylases ( EC 3.5.1.25 ). The domain is also found in the urease alpha subunit, where it is the catalytic domain [ (PUBMED:7754395) ].

GO function:hydrolase activity (GO:0016787)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Amidohydro_1