The domain within your query sequence starts at position 64 and ends at position 453; the E-value for the Amidohydro_1 domain shown below is 9.1e-35.

MVIPGGIDVNTYLQKPSQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGSSLLTSFEKW
HEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDLYQMSDSQLYE
AFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAIAIA
GRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVT
SPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMT
VVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKMKTITAK
SHKSTVEYNIFEGMECHGSPLVVISQGKIV

Amidohydro_1

Amidohydro_1
PFAM accession number:PF01979
Interpro abstract (IPR006680): Proteins containing this domain are enzymes from a large metal dependent hydrolase superfamily [(PUBMED:9144792)]. The family includes adenine deaminase (EC 3.5.4.2) that hydrolyses adenine to form hypoxanthine and ammonia. This reaction is important for adenine utilisation as a purine and also as a nitrogen source [(PUBMED:8550522)]. The family also includes dihydroorotase and N-acetylglucosamine-6-phosphate deacetylases (EC 3.5.1.25). The domain is also found in the urease alpha subunit, where it is the catalytic domain [(PUBMED:7754395)].
GO function:hydrolase activity (GO:0016787)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Amidohydro_1