The domain within your query sequence starts at position 160 and ends at position 520; the E-value for the Aminotran_1_2 domain shown below is 4.8e-59.

ENIINMASYNYLGLAGKYDDSMVRVKDTLEKYGVGVASTRNEMGTLDIHKELEDLMAEFL
NVEAVMSFGMGFATNAMNIPVFVGKGCLILSDEFNHTSVILGSRLSGAVIRPFKHNNAEN
LEKLLREAIIRGQPGTGRAWKKILIVVEGVYSMEGSIVNLAQIVALKKKYKAYLYIDEAH
SIGCTGPTGRGVRELFGLDPEDIDVYMGTFTKSFSGSGGYIGGKKEIVDYLRMQSHSTTY
ATSMSPVVAAQLIRSLKITMGYEGNIGGMERIQQLKENIKYFRRRLKEMGFIIYGNDFSP
VIPVLLYMPAKVSAFSRFLLKKKISVVVVGFPATSLPEGRARFSMSSAHTREMLDTVLEV
V

Aminotran_1_2

Aminotran_1_2
PFAM accession number:PF00155
Interpro abstract (IPR004839): Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue. On the basis of sequence similarity, these various enzymes can be grouped [(PUBMED:1990006)] into class I and class II. This entry includes proteins from both subfamilies.
GO process:biosynthetic process (GO:0009058)
GO function:pyridoxal phosphate binding (GO:0030170)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Aminotran_1_2