The domain within your query sequence starts at position 120 and ends at position 281; the E-value for the Aminotran_5 domain shown below is 4.9e-7.
IAPVFVLMEEEVLKKLRALVGWNSGDGVFCPGGSISNMYAMNLARFQRYPDCKQRGLRAL PPLALFTSKECHYSITKGAAFLGLGTDSVRVVKADERGRMIPEDLERQIILAEAEGSVPF LVSATSGTTVLGAFDPLDAIADVCQRHGLWFHVDAAWGGSVL
Aminotran_5 |
---|
PFAM accession number: | PF00266 |
---|---|
Interpro abstract (IPR000192): | Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue. On the basis of sequence similarity, these various enzymes can be grouped [ (PUBMED:8482384) ] into subfamilies. This entry represents an aminotransferase class-V domain, which is found in amino transferases and other related, though functionally distinct enzymes, including cysteine desulphurase. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Aminotran_5