The domain within your query sequence starts at position 120 and ends at position 281; the E-value for the Aminotran_5 domain shown below is 4.9e-7.

IAPVFVLMEEEVLKKLRALVGWNSGDGVFCPGGSISNMYAMNLARFQRYPDCKQRGLRAL
PPLALFTSKECHYSITKGAAFLGLGTDSVRVVKADERGRMIPEDLERQIILAEAEGSVPF
LVSATSGTTVLGAFDPLDAIADVCQRHGLWFHVDAAWGGSVL

Aminotran_5

Aminotran_5
PFAM accession number:PF00266
Interpro abstract (IPR000192): Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue. On the basis of sequence similarity, these various enzymes can be grouped [(PUBMED:8482384)] into subfamilies. This entry represents an aminotransferase class-V domain, which is found in amino transferases and other related, though functionally distinct enzymes, including cysteine desulphurase.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Aminotran_5