The domain within your query sequence starts at position 124 and ends at position 424; the E-value for the Aminotran_MocR domain shown below is 7.6e-9.

AFEMLINPGDTILVNEPLFPGTLYAMKPLGCNIINVPSDEHGIIPEGLKKILSQWKPEDS
KDPTKKTPKFLYTVPNGNNPTGNSLTGDRKKEIYELARKYDFLIIEDDPYYFLQFSKPWE
PTFLSMDVDGRVIRADTFSKTVSSGLRVGFMTGPKTLIQNIVLHTQVSSVHACTLSQLMI
LQLLHQWGEEGFLAHIDRTIDFYKNQRDSILAAADKWLRGLAEWHVPKAGMFLWIKVKGI
SDTKQLIEEKAIEREVLLVPGNGFFIDGSAPTSFFRASFSLATPAQMDTAFQRLAQLIKE
S

Aminotran_MocR

Aminotran_MocR
PFAM accession number:PF12897
Interpro abstract (IPR024551): This entry represents a family of putative aminotransferases.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Aminotran_MocR