The domain within your query sequence starts at position 21 and ends at position 400; the E-value for the Ammonium_transp domain shown below is 1.2e-50.

QTAFSLLFCFFIPHDTAQVDHRFMASYQVLRNLTLMAALGFGFLSSSFRRHSWSSVAFNL
FMLALGVQGTILLDHFLGQVLQWNKINNLSSIQIATMSTLPVLISAGAVLGKVNLVQLTV
MVLMEAMAFGAIRFADEKVFKMTEHIIMMHGHVFGAYFGLTVAWWLSRSLPRRVGENAQT
EKVQMATSSSLFAMLGTLFLWIFWPAINSALLEGTKKRNAVFNTYYALAVSAVTATSMSA
LSHPQGKINMVHIHNAVLAGGVAVGAPGCLISSPWISMVLGLIAGLISIWGAKCPRACLN
HMLQNSSGIHYTFGLPGLLGALTYYCLQIVTEPKSSDLWIITQTVTHIGALSFAVAMGMV
TGLLTGCLLSVRVWRAPRAA

Ammonium_transp

Ammonium_transp
PFAM accession number:PF00909
Interpro abstract (IPR024041):

This ammonium transporter domain consists of a duplication of 2 structural repeats of five helices each plus one extra C-terminal helix. It has been described as a channel that spans the membrane 11 times [(PUBMED:15361618)].

GO process:ammonium transport (GO:0015696)
GO component:membrane (GO:0016020)
GO function:ammonium transmembrane transporter activity (GO:0008519)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ammonium_transp