The domain within your query sequence starts at position 21 and ends at position 451; the E-value for the Amnionless domain shown below is 6.4e-142.

YKLWVPNTSFDTASNWNQNRTPCAGDAVQFPADKMVSVLVRDSHAISDMLLPLDGELVLA
SGAALSAAGGDSDPACNPGAPLLFRNPDRFSWLDPHLWSSGTQAPGLFSVDAERVPCSYD
DVLFPRDGSFRVALGPGPNPVHVRSVSAVGQTFSRDEDLTAFLASREGRLRFHGSGALRV
GSQACTDASGCVCGNAEMLPWICASLLQPLGGRCPQAACQDPLLPQGQCCDLCGAIVSLT
HDPTFDLERYRARLLDLFLKQPQYQGLQVAVSKVLRDAHTEIQVVLVETEHATGAAGQLG
HALLQDAVAQGSVLGIVSATLRQSGKPMTADSELNQSSSGAGLAGGVAALVLLALLGTVL
LLLHRSGRLRWRRHEDAEPVSAGLPLGFRNPIFDAIVFKQQPSVELPDSAQKVDILDIDT
KFGCFVNPLFA

Amnionless

Amnionless
PFAM accession number:PF14828
Interpro abstract (IPR026112):

Human amnionless (AMN) is necessary for efficient absorption of vitamin B12. Defects in AMN is a cause of recessive hereditary megaloblastic anemia 1 (RH-MGA1), also known as MGA1 Norwegian type or Imerslund-Grasbeck syndrome (I-GS)[(PUBMED:14576052)].

AMN may direct the production of trunk mesoderm during development by modulating a bone morphogenetic protein (BMP) signaling pathway in the underlying visceral endoderm [(PUBMED:11279523), (PUBMED:9851841)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Amnionless