The domain within your query sequence starts at position 189 and ends at position 398; the E-value for the Angiomotin_C domain shown below is 1.4e-100.

YVDKVEKMQQALVQLQAACEKREQLEHRLRTRLERELESLRIQQRQGNSQPTNASEYNAA
ALMELLREKEERILALEADMTKWEQKYLEENVMRHFALDAAATVAAQRDTTVISHSPNTS
YDTALEARIQKEEEEILMANKRCLDMEGRIKTLHAQIIEKDAMIKVLQQRSRKEPSKTEQ
LSSMRPAKSLMSISNAGSGLLAHSSTLTGA

Angiomotin_C

Angiomotin_C
PFAM accession number:PF12240
Interpro abstract (IPR024646):

This domain represents the C-terminal region of angiomotin. Angiomotin regulates the action of angiogenesis-inhibitor angiostatin [(PUBMED:11257124)]. The C-terminal region of angiomotin appears to be involved in directing the protein chemotactically [(PUBMED:12902404)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Angiomotin_C