The domain within your query sequence starts at position 423 and ends at position 501; the E-value for the Anillin_N domain shown below is 2.7e-6.
KQEREKELACLRGRLDKGNLWSAEKNEKSRSKHLETKQEVHCQNTPLKKHQTVASTPLTS VTDKVAENEPAVKLSSTEP
Anillin_N |
---|
PFAM accession number: | PF16018 |
---|---|
Interpro abstract (IPR031970): | This domain is found towards the N terminus of anillin (ANLN), a F-actin-binding protein with important roles in cell cytokinesis [ (PUBMED:20732437) (PUBMED:24676636) ]. In mammalian anillin, this domain is repeated. This domain overlaps with the region responsible for nuclear localisation of anillin [ (PUBMED:10931866) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Anillin_N