The domain within your query sequence starts at position 423 and ends at position 501; the E-value for the Anillin_N domain shown below is 2.7e-6.

KQEREKELACLRGRLDKGNLWSAEKNEKSRSKHLETKQEVHCQNTPLKKHQTVASTPLTS
VTDKVAENEPAVKLSSTEP

Anillin_N

Anillin_N
PFAM accession number:PF16018
Interpro abstract (IPR031970):

This domain is found towards the N terminus of anillin (ANLN), a F-actin-binding protein with important roles in cell cytokinesis [(PUBMED:20732437), (PUBMED:24676636)]. In mammalian anillin, this domain is repeated. This domain overlaps with the region responsible for nuclear localisation of anillin [(PUBMED:10931866)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Anillin_N