The domain within your query sequence starts at position 156 and ends at position 381; the E-value for the Anoct_dimer domain shown below is 2.9e-70.

LFKDGKKRIDYILVYRKTNIQYDKRNTFEKNLRAEGLMLEKEPAIANPDIMFIKIHIPWD
TLCKYAERLNIRVPFRKKCYYTDQKNKSKSRVQNYFKRIKKWMSQNPMVLDKSAFPELEE
SDCYTGPFSRARIHHFIINNKDTFFSNATRSRIVYHMLERTKYENGISKVGIRKLITNGS
YIAAFPPHEGAYKSSLPIKTHGPQNNRHLLYERWARWGMWYKHQPL

Anoct_dimer

Anoct_dimer
PFAM accession number:PF16178
Interpro abstract (IPR032394):

This appears to be the cytoplasmic domain of the calcium-activated chloride-channel anoctamin [(PUBMED:22946059)]. It is responsible for creating the homodimeric architecture of the chloride-channel proteins [(PUBMED:23576756)].

GO function:protein dimerization activity (GO:0046983)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Anoct_dimer