The domain within your query sequence starts at position 469 and ends at position 498; the E-value for the Antistasin domain shown below is 4.5e-10.

CGELSNCSLKEKDCVYGFKLDHNGCRTCQC

Antistasin

Antistasin
PFAM accession number:PF02822
Interpro abstract (IPR004094):

Antistatin is a small, disulphide cross-linked serine protease inhibitor isolated from the salivary glands of the Mexican leech. It is a potent anticoagulant by virtue of its ability to inhibit factor Xa in the coagulation cascade. Antistatin also exhibits a strong antimetastatic activity. It contains internal repeats of a 25-26 amino acid sequence with a highly conserved pattern of 6 cysteine (Cys) and 2 glycine residues [(PUBMED:1516699)]. Many metazoan proteins share sequence homology with this antistasin-like domain. The unique physical properties of these related Cys-rich proteins (protease resistance; heat, chemical resilience) appear to stem from the common six Cys loop that is cross-linked by three disulfide bonds [(PUBMED:15013771)]. Disulfide linkages are between Cys1-Cys4, Cys2-Cys5, and Cys3-Cys6 [(PUBMED:16523290), (PUBMED:10512718)].

The antistasin-like domain consists of very short antiparallel beta-sheets and interacts with proteinases [(PUBMED:10512718)].

GO function:serine-type endopeptidase inhibitor activity (GO:0004867)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Antistasin