The domain within your query sequence starts at position 110 and ends at position 204; the E-value for the Aph-1 domain shown below is 1.4e-28.
APSMRLLAYAFMTLVVIMLHVFWGVVFFDGCEKNKWYTLLTVLLTHLVVSTQTFLSPYYE VNLVTAYIIMVLMGIWAFYVAGGSCRSLKLCLLCQ
Aph-1 |
![]() |
---|
PFAM accession number: | PF06105 |
---|---|
Interpro abstract (IPR009294): | This family consists of several eukaryotic Aph-1 proteins. Aph-1 is an essential subunit of the gamma-secretase complex, an endoprotease complex that catalyses the intramembrane proteolysis of Notch, beta-amyloid precursor protein, and other substrates as part of a new signalling paradigm and as a key step in the pathogenesis of Alzheimer's disease [ (PUBMED:12110170) ]. It is thought that the presenilin heterodimer comprises the catalytic site and that a highly glycosylated form of nicastrin associates with it. Aph-1 and Pen-2, two membrane proteins genetically linked to gamma-secretase, associate directly with presenilin and nicastrin in the active protease complex. Co-expression of all four proteins leads to marked increases in presenilin heterodimers, full glycosylation of nicastrin, and enhanced gamma-secretase activity [ (PUBMED:12740439) ]. |
GO process: | positive regulation of catalytic activity (GO:0043085), protein processing (GO:0016485) |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Aph-1