The domain within your query sequence starts at position 24 and ends at position 98; the E-value for the ApoA-II domain shown below is 2.1e-43.
QADGPDMQSLFTQYFQSMTDYGKDLMEKAKTSEIQSQAKAYFEKTHEQLTPLVRSAGTSL VNFFSSLMNLEEKPA
ApoA-II |
 |
|---|
| PFAM accession number: | PF04711 |
|---|---|
| Interpro abstract (IPR006801): | Apolipoprotein A-II (ApoA-II) is the second major apolipoprotein of high density lipoprotein in human plasma. Mature ApoA-II is present as a dimer of two 77-amino acid chains joined by a disulphide bridge [ (PUBMED:12119188) ]. ApoA-II regulates many steps in HDL metabolism, and its role in coronary heart disease is unclear [ (PUBMED:12119188) ]. In bovine serum, the ApoA-II homologue is present in almost free form. Bovine ApoA-II shows antimicrobial activity against Escherichia coli and yeasts in phosphate buffered saline (PBS) [ (PUBMED:9538260) ]. |
| GO process: | lipid transport (GO:0006869), lipoprotein metabolic process (GO:0042157) |
| GO component: | extracellular region (GO:0005576) |
| GO function: | lipid binding (GO:0008289) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ApoA-II