The domain within your query sequence starts at position 27 and ends at position 87; the E-value for the ApoC-I domain shown below is 1.7e-33.
APDLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTT F
ApoC-I |
---|
PFAM accession number: | PF04691 |
---|---|
Interpro abstract (IPR006781): | Exchangeable apolipoproteins are water-soluble protein components of lipoproteins that solubilise lipids and regulate their metabolism by binding to cell receptors or activating specific enzymes. Apolipoprotein C-I (ApoC-1) is the smallest exchangeable apolipoprotein and transfers among HDL (high density lipoprotein), VLDL (very low-density lipoprotein) and chlylomicrons. ApoC-1 activates lecithin:choline acetyltransferase (LCAT), inhibits cholesteryl ester transfer protein, can inhibit hepatic lipase and phospholipase 2 and can stimulate cell growth. ApoC-1 delays the clearance of beta-VLDL by inhibiting its uptake via the LDL receptor-related pathway [ (PUBMED:11580293) ]. ApoC-1 has been implicated in hypertriglyceridemia [ (PUBMED:11353333) ], and Alzheimer s disease [ (PUBMED:11741391) ]. ApoC-1 is believed to comprise of two dynamic helices that are stabilised by interhelical interactions and are connected by a short linker region. The minimal folding unit in the lipid-free state of this and other exchangeable apolipoproteins comprises the helix-turn-helix motif formed of four 11-mer sequence repeats. |
GO process: | lipoprotein metabolic process (GO:0042157) |
GO component: | extracellular region (GO:0005576) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ApoC-I