The domain within your query sequence starts at position 28 and ends at position 328; the E-value for the ApoL domain shown below is 1e-90.

KFLRTDLRSLITEDGAWNGFVEAAELSREEGEALRDALKERLAQDPTDENDRPQREQQKE
RFLREFPQLKKKLEDHIRKLRELADKFDQVHKDCTISNVVSTSASAASGVLALLGLALST
VTAGASLALSASSVALGATSSVSSFTTTAVEESMRLSYESEARNLIGASMNVLEEILKIM
PKITYKFYSTVADLAEAFKTLKDQIQTIRRARSISRRGAQARNLPSTGRSSGQVVPQMTR
GARFQKGVFTSVLLGWDVYDLVNQSKDLYYGAKTKSGGALRDLARKLEENLQEFEQKCKA
L

ApoL

ApoL
PFAM accession number:PF05461
Interpro abstract (IPR008405): Apo L belongs to the high density lipoprotein family that plays a central role in cholesterol transport. The cholesterol content of membranes is important in cellular processes such as modulating gene transcription and signal transduction both in the adult brain and during neurodevelopment. There are six apo L genes located in close proximity to each other on chromosome 22q12 in humans. 22q12 is a confirmed high-susceptibility locus for schizophrenia and close to the region associated with velocardiofacial syndrome that includes symptoms of schizophrenia [(PUBMED:11930015)]. The various functions of apoL are still not entirely clear. Apolipoprotein L-I has been identified as a trypanolytic agent [(PUBMED:12621437)] and displays similar phylogenetic distribution to the programmed cell death protein Bcl-2 and BH-3 domain-containing proteins, suggesting a possible role in apoptosis [(PUBMED:16847577)].
GO process:lipid transport (GO:0006869), lipoprotein metabolic process (GO:0042157)
GO component:extracellular region (GO:0005576)
GO function:lipid binding (GO:0008289)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ApoL