The domain within your query sequence starts at position 78 and ends at position 156; the E-value for the AraC_binding domain shown below is 1.3e-8.
EEKIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEKGDMITLPAGIYHRFTL DEKNYVKAMRLFVGEPVWT
AraC_binding |
---|
PFAM accession number: | PF02311 |
---|---|
Interpro abstract (IPR003313): | This entry defines the ligand-binding and dimerisation domain of the bacterial regulatory protein AraC and other HTH-type transcriptional regulators. The crystal structure of the arabinose-binding and dimerisation domain of the Escherichia coli gene regulatory protein AraC was determined in the presence and absence of L-arabinose. The arabinose-bound molecule shows that the protein adopts an unusual fold, binding sugar within a beta barrel and completely burying the arabinose with the amino-terminal arm of the protein. Dimer contacts in the presence of arabinose are mediated by an antiparallel coiled-coil. In the uncomplexed protein, the amino-terminal arm is disordered, uncovering the sugar-binding pocket and allowing it to serve as an oligomerization interface [ (PUBMED:9103202) ]. |
GO process: | regulation of transcription, DNA-templated (GO:0006355) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AraC_binding