The domain within your query sequence starts at position 78 and ends at position 228; the E-value for the Arb2 domain shown below is 3.5e-44.

TGEPFVFNYREDLHRWNQKRYEALGEIITRYVYELLESDCNLKKISIPVDATESEPKSFI
FMSEDALTNPQKLMVLIHGSGVVRAGQWARRLIINEDLDSGTQIPFIKRAMDEGYGVIVL
NPNENYIEVEKQKMHKQSSSSDGTDEPAGKR

Arb2

Arb2
PFAM accession number:PF09757
Interpro abstract (IPR019154):

This domain is found at the C-terminal of Clr3 (Cryptic loci regulator 3) also known as histone deacetylase clr3 (EC:3.5.1.98). Structure analysis reveals that the Arb2 domain has clear homology to alpha/beta-hydrolases but that it is lacking the catalytic triad of these enzymes. Functional studies show that the Arb2 domain is necessary for centromeric heterochromatin silencing suggesting a model where the Arb2 domain, through residues N562 and Y563, acts as an anchor that connects the HDAC activity of Clr3 to the SHREC complex. SHREC (Snf2/Hdac Repressive) complex in fission yeast drives transcriptional gene silencing in heterochromatin [(PUBMED:27105116)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Arb2