The domain within your query sequence starts at position 8 and ends at position 403; the E-value for the Arginosuc_synth domain shown below is 1.9e-177.

VLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSKE
FVEEFIWPAVQSSALYEDRYLLGTSLARPCIARRQVEIAQREGAKYVSHGATGKGNDQVR
FELTCYSLAPQIKVIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTPKSPWSMDENLMH
ISYEAGILENPKNQAPPGLYTKTQDPAKAPNSPDVLEIEFKKGVPVKVTNIKDGTTRTTS
LELFMYLNEVAGKHGVGRIDIVENRFIGMKSRGIYETPAGTILYHAHLDIEAFTMDREVR
KIKQGLGLKFAELVYTGFWHSPECEFVRHCIQKSQERVEGKVQVSVFKGQVYILGRESPL
SLYNEELVSMNVQGDYEPIDATGFININSLRLKEYH

Arginosuc_synth

Arginosuc_synth
PFAM accession number:PF00764
Interpro abstract (IPR001518):

Argininosuccinate synthase (EC 6.3.4.5) (AS) is a urea cycle enzyme that catalyzes the penultimate step in arginine biosynthesis: the ATP-dependent ligation of citrulline to aspartate to form argininosuccinate, AMP and pyrophosphate [(PUBMED:2123815), (PUBMED:3133361)].

In humans, a defect in the AS gene causes citrullinemia, a genetic disease characterised by severe vomiting spells and mental retardation.

AS is a homotetrameric enzyme of chains of about 400 amino-acid residues. An arginine seems to be important for the enzyme's catalytic mechanism. The sequences of AS from various prokaryotes, archaebacteria and eukaryotes show significant similarity.

GO process:arginine biosynthetic process (GO:0006526)
GO function:argininosuccinate synthase activity (GO:0004055), ATP binding (GO:0005524)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Arginosuc_synth