The domain within your query sequence starts at position 430 and ends at position 512; the E-value for the ArgoMid domain shown below is 1.4e-34.

TPSHGVWDMRGKQFHTGVEIKMWAIACFATQRQCREEILKGFTDQLRKISKDAGMPIQGQ
PCFCKYAQGADSVEPMFRHLKNT

ArgoMid

ArgoMid
PFAM accession number:PF16487
Interpro abstract (IPR032473):

This domain (Mid) is found to be part of the Piwi-lobe of the argonaute proteins. It is composed of a parallel four-stranded beta-sheet core surrounded by four alpha-helices and two additional short alpha-helices. It most closely resembles the amino terminal tryptic core of the E.coli lactose repressor. There is an extensive interface between the Mid and the Piwi domains. The conserved C-terminal half or the Mid has extensive interactions with Piwi, with a deep basic pocket on the surface of the `Mid adjacent to the interface with Piwi. The Mid carries a binding pocket for the 5' phosphate overhang of the guide strand of DNA [(PUBMED:16061186)]. The N, Mid, and Piwi domains form a base upon which the PAZ domain sits, resembling a duck. The 5' phosphate and the U1 base are held in place by a conserved network of interactions from protein residues of the Mid and Piwi domains in order to place the guide uniquely in the proper position observed in all Argonaute-RNA complexes [(PUBMED:23746446)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ArgoMid