The domain within your query sequence starts at position 92 and ends at position 245; the E-value for the ArgoN domain shown below is 6.5e-10.

CKTGSSGIPVRLVTNLFNLDLPQDWQLYQYHVTYSPDLASRRLRIALLYNHSILSDKAKA
FDGASLFLSEKLDQKVTELTSETQRGETIKITLTLTSKLFPNSPVCIQFFNVIFRKILKN
LSMYQIGRNFYKPSEPVEIPQYKLSLWPGFAISV

ArgoN

ArgoN
PFAM accession number:PF16486
Interpro abstract (IPR032474):

This entry represents the N-terminal domain of argonaute proteins from eukaryotes. This domain is composed of an antiparallel four-stranded beta sheet core that has two alpha helices positioned along one face of the sheet and an extended beta strand towards its N terminus. The core fold of the N domain most closely resembles the catalytic domain of replication-initiator protein Rep. The N domain is linked to the PAZ domain via linker 1 region, and together these three regions are designated the PAZ-containing lobe of argonaute [(PUBMED:16061186)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ArgoN