The domain within your query sequence starts at position 48 and ends at position 234; the E-value for the Arm_2 domain shown below is 6.5e-86.

TDGSYDDILNAEQLKKLLYLLESTDDPVITEKALVTLGNNAAFSTNQAIIRELGGIPIVG
NKINSLNQSIKEKALNALNNLSVNVENQTKIKIYVPQVCEDVFADPLNSAVQLAGLRLLT
NMTVTNDYQHLLSGSVAGLFHLLLLGNGSTKVQVLKLLLNLSENPAMTEGLLSVQVSRLP
TRFISAH

Arm_2

Arm_2
PFAM accession number:PF04826
Interpro abstract (IPR006911):

This domain contains armadillo-like repeats [(PUBMED:15034937)]. Proteins containing this domain interact with numerous other proteins, through these interactions they are involved in a wide variety of processes including carcinogenesis [(PUBMED:17904127)], control of cellular ageing and survival [(PUBMED:15034937)], regulation of circadian rhythm [(PUBMED:11597585)] and lysosomal sorting of G protein-coupled receptors [(PUBMED:12142540)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Arm_2