The domain within your query sequence starts at position 48 and ends at position 234; the E-value for the Arm_2 domain shown below is 6.5e-86.
TDGSYDDILNAEQLKKLLYLLESTDDPVITEKALVTLGNNAAFSTNQAIIRELGGIPIVG NKINSLNQSIKEKALNALNNLSVNVENQTKIKIYVPQVCEDVFADPLNSAVQLAGLRLLT NMTVTNDYQHLLSGSVAGLFHLLLLGNGSTKVQVLKLLLNLSENPAMTEGLLSVQVSRLP TRFISAH
Arm_2 |
---|
PFAM accession number: | PF04826 |
---|---|
Interpro abstract (IPR006911): | This domain contains armadillo-like repeats [ (PUBMED:15034937) ]. Proteins containing this domain interact with numerous other proteins, through these interactions they are involved in a wide variety of processes including carcinogenesis [ (PUBMED:17904127) ], control of cellular ageing and survival [ (PUBMED:15034937) ], regulation of circadian rhythm [ (PUBMED:11597585) ] and lysosomal sorting of G protein-coupled receptors [ (PUBMED:12142540) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Arm_2