The domain within your query sequence starts at position 564 and ends at position 826; the E-value for the ArsB domain shown below is 4.6e-2.

TAVRGLLLEKVLALEHLLAQRLHTFHRQISQEDKNWETNIQELQRKHRISDRSLLVKCLT
VLGFVISMFFLNSFVPGIHLDLGWIAILGAIWLLILADIHDFEIILHRVEWATLLFFAAL
FVLMEALTHLHLVEYVGEQTALLIKMVPEDQRFAAAIVLIVWVSALASSLIDNIPFTATM
IPVLLNLSQDPEISLPALPLMYALALGACLGGNGTLIGASTNVVCAGIAEKHGYGFSFME
FFRLGFPVMLMSCTIGMCYLLIA

ArsB

ArsB
PFAM accession number:PF02040
Interpro abstract (IPR000802):

Arsenic is a toxic metalloid whose trivalent and pentavalent ions inhibit a variety of biochemical processes. Operons that encode arsenic resistance have been found in multicopy plasmids from both Gram-positive and Gram-negative bacteria [ (PUBMED:7721697) ]. The resistance mechanism is encoded from a single operon, which houses an anion pump. The pump has two polypeptide components: a catalytic subunit (the ArsA protein), which functions as an oxyanion-stimulated ATPase; and an arsenite export component (the ArsB protein), which is associated with the inner membrane [ (PUBMED:1688427) ]. The ArsA and ArsB proteins are thought to form a membrane complex that functions as an anion-translocating ATPase.

The ArsB protein is distinguished by its overall hydrophobic character, in keeping with its role as a membrane-associated channel. Sequence analysis reveals the presence of 13 putative transmembrane (TM) regions.

GO process:arsenite transport (GO:0015700)
GO component:integral component of membrane (GO:0016021)
GO function:arsenite transmembrane transporter activity (GO:0015105)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ArsB