The domain within your query sequence starts at position 1189 and ends at position 1422; the E-value for the Asp_Glu_race_2 domain shown below is 3.6e-157.
EAGMVPDPEHLNYIVKLLHQAQASQQEISAVLQAKSRLRVRQLKKNWKCDLDSALSEVET CKEKSDWTKLGNLYISIKMSCEEFADLQRFCACVAETLTEDYKEERPGVPFCEFAETVSK DPQYSEVDKTLLGRIGISAVYFYHRLLLWAKGRKVLDILYELKIHFTSLKGLTGPEKEAP RCQIVNVAAEIFIKSGSLDGAIWVLRESEWIINTPLWPCDRMDVLNRHNLLCTI
Asp_Glu_race_2 |
---|
PFAM accession number: | PF14669 |
---|---|
Interpro abstract (IPR029435): | This domain is found in protein TOPAZ1, which may play an important role in germ cell development [ (PUBMED:22069478) ]. Homology suggests that it is a putative aspartate racemase. Protein TOPAZ1 was previously called testis and ovary-specific PAZ domain-containing protein 1 [ (PUBMED:22069478) ], but the name was changed to Protein TOPAZ1 as it does not contain a PAZ domain. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Asp_Glu_race_2