The domain within your query sequence starts at position 226 and ends at position 349; the E-value for the Asp_protease domain shown below is 3.3e-63.

QQNIEENMNIAMEEAPESFGQVAMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIM
RLVDRRWGGVAKGVGTQRIMGRVHLAQIQIEGDFLQCSFSILEEQPMDILLGLDMLRRHQ
CSID

Asp_protease

Asp_protease
PFAM accession number:PF09668
Interpro abstract (IPR019103):

This domain is found in eukaryotic aspartyl protease DDI1 (DNA Damage Inducible protein 1; MEROPS identifier A28.001). The remarkable structural similarity between this central domain of DDI1 and the retroviral proteases suggests that DDI1 functions proteolytically during regulated protein turnover [(PUBMED:17010377), (PUBMED:15964793)]. DDI1 has been shown to activate an endoplasmic-reticulum isoform of the transcription factor SKN-1 in Caenorhabditis elegans when the proteasome is dysfunctional [(PUBMED:27528192)]. DDI1 also has an amino-terminal ubiquitin-like domain and/or a UBA (ubiquitin-associated) domain [(PUBMED:27646017)].

GO process:proteolysis (GO:0006508)
GO function:aspartic-type endopeptidase activity (GO:0004190)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Asp_protease