The domain within your query sequence starts at position 9 and ends at position 163; the E-value for the AstE_AspA domain shown below is 4.7e-42.
PIKKIAIFGGTHGNELTGVFLVTHWLRNGTEVHRAGLDVKPFITNPRAVEKCTRYIDCDL NRVFDLENLSKEMSEDLPYEVRRAQEINHLFGPKNSDDAYDLVFDLHNTTSNMGCTLILE DSRNDFLIQMFHYIKTCMAPLPCSVYLIEHPSLKY
AstE_AspA |
---|
PFAM accession number: | PF04952 |
---|---|
Interpro abstract (IPR007036): | This family describes both succinylglutamate desuccinylase that catalyses the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway and also includes aspartoacylase EC 3.5.1.15 which cleaves acylaspartate into a fatty acid and aspartate. Mutations in P45381 lead to Canavan disease [ (PUBMED:8252036) ]. |
GO function: | hydrolase activity, acting on ester bonds (GO:0016788) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AstE_AspA