The domain within your query sequence starts at position 1 and ends at position 61; the E-value for the Atg8 domain shown below is 2e-25.

MSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETF
G

Atg8

Atg8
PFAM accession number:PF02991
Interpro abstract (IPR004241):

A number of autophagy-related proteins have been identified in yeast, including the key autophagic protein Atg8, which is a ubiquitin-like protein with a structure consisting of two amino-terminal alpha-helices and a ubiquitin-like core [(PUBMED:18508918), (PUBMED:15265004)]. Many other eukaryotes contain multiple Atg8 orthologues. Atg8 genes of multicellular animals can be divided into three subfamilies: microtubule-associated protein 1 light chain 3 (MAP1LC3 or LC3) [(PUBMED:7908909)], gamma-aminobutyric acid receptor-associated protein (GABARAP) and Golgi-associated ATPase enhancer of 16 kDa (GATE-16) [(PUBMED:21867568), (PUBMED:20562859)]. Family members are involved in diverse intracellular trafficking and autophagy processes.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Atg8