The domain within your query sequence starts at position 370 and ends at position 467; the E-value for the Atx10homo_assoc domain shown below is 4.7e-38.

FKSHLIRLIGNLCYKNKENQDKVNELDGIPLILDSSNIDDNNPFMMQWVVYAVRNLTEDN
SQNQDVIAKMEEQGLADASLLKKMGFEIEKSGDKLILK

Atx10homo_assoc

Atx10homo_assoc
PFAM accession number:PF09759
Interpro abstract (IPR019156):

This is the conserved C-terminal 100 residues of Ataxin-10. Ataxin-10 belongs to the family of armadillo repeat proteins and in solution it tends to form homotrimeric complexes, which associate via a tip-to-tip association in a horseshoe-shaped contact with the concave sides of the molecules facing each other. This domain may represent the homo-association site since that is located near the C terminus of Ataxin-10. The protein does not contain a signal sequence for secretion or any subcellular compartment confirming its cytoplasmic localisation, specifically to the olivocerebellar region [(PUBMED:15201271)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Atx10homo_assoc