The domain within your query sequence starts at position 82 and ends at position 282; the E-value for the Auts2 domain shown below is 4.8e-73.
KPGKWCAMHVRVAYMILRHQEKMKGDSHKLDFRNDLLPCLPGPYGALPPGQELSHPASLF TATGAVHAAANPFTTAPGAHGPFLSPSTHIDPFGRPTSFASLAALSNGAFGGLGSPTFNS SAVFAQKESPGAPPAFASPPDPWGRLHRSPLAFPAWVRPPETARTPGSDKERPMERREPS VTKEEKDRDLPFSRPQLRVSP
Auts2 |
---|
PFAM accession number: | PF15336 |
---|---|
Interpro abstract (IPR023246): | AUTS2 is a novel gene identified in a monozygotic twin pair with autism; its translation product is a large protein containing 1,295 amino acids [ (PUBMED:12160723) ]. Following DNA sequence analysis of autism subjects and controls, no autism-specific mutation was observed. Association and linkage analyses were also negative. It is hence considered unlikely that AUTS2 is an autism suspecptibility gene for idiopathic autism, although it may be the gene responsible for the disorder in the twins in this study [ (PUBMED:12160723) ]. The AUTS2 gene product shares a high level of similarity with the so-called fibrosin-1-like protein, a functionally uncharacterised polypeptide that contains C-terminal Ala-rich and Pro-rich regions. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Auts2