The domain within your query sequence starts at position 16 and ends at position 209; the E-value for the Avl9 domain shown below is 3.9e-86.

VLHIVVVGFHHKKGCQVEFSYPPLIPGDGHDSHTLPEEWKYLPFLALPDGAHNYQEDTVF
FHLPPRNGNGATVYGISCYRQIEAKALKVRQADITRETVQKSVCVLSKLPLYGLLQAKLQ
LITHAYFEEKDFSQISILKELYEHMNSSLGGASLEGSQVYLGLSPRDLVLHFRHKVLILF
KLILLEKKVRYRRI

Avl9

Avl9
PFAM accession number:PF09794
Interpro abstract (IPR018307):

This domain is found in late secretory protein Avl9, which is required for the generation of secretory vesicles as well as for actin polarization and polarized growth. It is also found in DENND6 proteins, which act as guanine nucleotide exchange factors (GEF) for RAB14 [(PUBMED:22595670)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Avl9