The domain within your query sequence starts at position 432 and ends at position 472; the E-value for the Axin_b-cat_bind domain shown below is 7.6e-13.
EEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHQ
Axin_b-cat_bind |
---|
PFAM accession number: | PF08833 |
---|---|
Interpro abstract (IPR014936): | Proteins in this entry are found on the scaffolding protein Axin which is a component of the beta-catenin destruction complex. It competes with the tumour suppressor adenomatous polyposis coli protein (APC) for binding to beta-catenin [ (PUBMED:14600025) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Axin_b-cat_bind