The domain within your query sequence starts at position 174 and ends at position 250; the E-value for the B-block_TFIIIC domain shown below is 5.1e-20.

PDFSYCILERLGRSRWQGELQRDLHTTAFKVDAGKLHYHRKILNKNGLITMQSHVIRLPT
GAQQHSILLLLNRFHVD

B-block_TFIIIC

B-block_TFIIIC
PFAM accession number:PF04182
Interpro abstract (IPR007309):

Yeast transcription factor IIIC (TFIIIC) is a multisubunit protein complex that interacts with two control elements of class III promoters called the A and B blocks. This family represents the subunit within TFIIIC involved in B-block binding [(PUBMED:1279682)]. Although defined as a yeast protein, it is also found in a number of other organisms.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry B-block_TFIIIC