The domain within your query sequence starts at position 11 and ends at position 79; the E-value for the B12D domain shown below is 5.3e-38.

SWDRKNNPEPWNKLGPNEQYKFYSVNVDYSKLKKEGPDF

B12D

B12D
PFAM accession number:PF06522
Interpro abstract (IPR010530):

The MLRQ subunit of mitochondrial NADH-ubiquinone reductase complex I is nuclear [ (PUBMED:1518044) ] and is found in plants [ (PUBMED:11473698) ], insects, fungi and higher metazoans [ (PUBMED:15843018) ]. It appears to act within the membrane and, in mammals, is highly expressed in muscle and neural tissue, indicative of a role in ATP generation [ (PUBMED:15843018) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry B12D