The domain within your query sequence starts at position 48 and ends at position 453; the E-value for the B56 domain shown below is 3.2e-195.

LPLLKDVPTSEQPELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCL
TEQTYPEVVRMVSCNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEF
QPSIAKKYIDQKFVLQLLELFDSEDPRERDYLKTVLHRIYGKFLGLRAFIRKQINNIFLR
FVYETEHFNGVAELLEILGSIINGFALPLKAEHKQFLVKVLIPLHTVRSLSLFHAQLAYC
IVQFLEKDPSLTEPVIRGLMKFWPKTCSQKEVMFLGELEEILDVIEPSQFVKIQEPLFKQ
IAKCVSSPHFQVAERALYYWNNEYIMSLIEENSNVILPIMFSSLYRISKEHWNPAIVALV
YNVLKAFMEMNSTMFDELTATYKSDRQREKKKEKEREELWKKLEDL

B56

B56
PFAM accession number:PF01603
Interpro abstract (IPR002554): Protein phosphatase 2A (PP2A) is a major intracellular protein phosphatase that regulates multiple aspects of cell growth and metabolism. The ability of this widely distributed heterotrimeric enzyme to act on a diverse array of substrates is largely controlled by the nature of its regulatory B subunit. There are multiple families of B subunits, this family is called the B56 family [(PUBMED:7592815)].
GO process:signal transduction (GO:0007165)
GO component:protein phosphatase type 2A complex (GO:0000159)
GO function:protein phosphatase regulator activity (GO:0019888)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry B56