The domain within your query sequence starts at position 1 and ends at position 89; the E-value for the B9-C2 domain shown below is 2.6e-20.

NDVVRGYGAVHVPLSPGRTSLYENICFRHKRTIPMFVPESTSTLQKFTSWFMGRRPEYTD
PKVVAQGEGREVTRVRSQGFVTLLFNVVT

B9-C2

B9-C2
PFAM accession number:PF07162
Interpro abstract (IPR010796):

B9 domain containing proteins are found in flagellar or cilia-containing species. Although its function is unknown, a cilia-specific role has been suggested for the poorly characterised B9 domain [ (PUBMED:16415886) (PUBMED:17127412) (PUBMED:18337471) ].

Some proteins known to contain a B9 domain are listed below:

  • Mammalian Meckel syndrome 1 (MKS1) protein, which may be related to the ciliary basal body.
  • Mammalian protein B9D1 and B9D2.
  • Caenorhabditis elegans X-box promoter element regulated protein 7 (xbx-7). It corresponds to mammalian MKS1.
  • Caenorhabditis elegans ciliary transition zone associate protein 1 (tza-1). It corresponds to mammalian B9D2.
  • Caenorhabditis elegans ciliary transition zone associate protein 2 (tza-2). It corresponds to mammalian B9D1.
  • Paramecium tetraurelia ICIS-1 (Involved in Cilia Stability-1), the B9D2 homologue.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry B9-C2