The domain within your query sequence starts at position 85 and ends at position 178; the E-value for the BAH domain shown below is 2.1e-9.
VVYRPGDCVYIESRRPNTPYFICSIQDFKLSKRDHLLMNVKWYYRQSEVPDSVYQHLVQD RHNENDSGRELVITDPVIKNRELFISDYVDTYHA
BAH |
 |
|---|
| PFAM accession number: | PF01426 |
|---|---|
| Interpro abstract (IPR001025): | The BAH (bromo-adjacent homology) is commonly found in chromatin-associated proteins [ (PUBMED:23907388) ]. It is found in proteins such as eukaryotic DNA (cytosine-5) methyltransferases IPR001525 the origin recognition complex 1 (Orc1) proteins, as well as several proteins involved in transcriptional regulation. The BAH domain appears to act as a protein-protein interaction module specialised in gene silencing, as suggested for example by its interaction within yeast Orc1p with the silent information regulator Sir1p. The BAH module might therefore play an important role by linking DNA methylation, replication and transcriptional regulation [ (PUBMED:10100640) ]. |
| GO function: | chromatin binding (GO:0003682) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BAH