The domain within your query sequence starts at position 264 and ends at position 432; the E-value for the BAR domain shown below is 4e-10.
QRIIKEEIEYLVELREYGPVYSTWSALEGELAEPLEGVSACIGNCSTALEELTDDITEEF LPVLREYVLYSDSMKGVLKKRDQVQAEYEAKLEAVALRKEERPKVPADVEKCQDRMECFN ADLKADMERWQSNKRHDFRQLLVGLADKNIQYYEKCLMAWESIIPLLQE
BAR |
---|
PFAM accession number: | PF03114 |
---|---|
Interpro abstract (IPR004148): | Endocytosis and intracellular transport involve several mechanistic steps:
The crystal structure of these proteins suggest the domain forms a crescent-shaped dimer of a three-helix coiled coil with a characteristic set of conserved hydrophobic, aromatic and hydrophilic amino acids. Proteins containing this domain have been shown to homodimerise, heterodimerise or, in a few cases, interact with small GTPases. |
GO component: | cytoplasm (GO:0005737) |
GO function: | protein binding (GO:0005515) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BAR