The domain within your query sequence starts at position 358 and ends at position 593; the E-value for the BAR_3_WASP_bdg domain shown below is 2.4e-120.
DEKEWKTGKRKAEKDELVGVMIFSTMEPEAPDLDLIEIEQKCDAVGKFTKAMDDGVKELL TVGQEHWKRCTGPLPKEYQKIGKALQSLAAVFSSSGYQGETDLNDAITEAGKTYEEIASL VAEQPKKDLHFLMECNHEYKGFLGCFPDIIGAHKGAIEKVKESDKLVATSKITPQDKQTM VKRVGTMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFP
BAR_3_WASP_bdg |
---|
PFAM accession number: | PF10456 |
---|---|
Interpro abstract (IPR019497): | The C-terminal region of the Sorting nexin group of proteins appears to carry a BAR-like (Bin/amphiphysin/Rvs) domain. This domain is very diverse and the similarities with other BAR domains are few. In the Sorting nexins it is associated with IPR001683 and in combination with PX appears to be necessary to bind WASP along with p85 to form a multimeric signalling complex [ (PUBMED:14993925) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BAR_3_WASP_bdg